Anti IFT122 pAb (ATL-HPA041815)

Atlas Antibodies

Catalog No.: ATL-HPA041815-25

Protein Description: intraflagellar transport 122
Gene Name: IFT122
Alternative Gene Name: SPG, WDR10, WDR10p, WDR140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030323: 91%, ENSRNOG00000010952: 91%
Entrez Gene ID: 55764
Uniprot ID: Q9HBG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLK
• Gene Sequence: ITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLK
• Gene ID - Mouse: ENSMUSG00000030323
• Gene ID - Rat: ENSRNOG00000010952
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFT122 pAb (ATL-HPA041815) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.