Anti IFI30 pAb (ATL-HPA026650 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026650-25

Protein Description: interferon, gamma-inducible protein 30
Gene Name: IFI30
Alternative Gene Name: GILT, IFI-30, IP30, MGC32056
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110777: 71%, ENSRNOG00000019387: 74%
Entrez Gene ID: 10437
Uniprot ID: P13284
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
• Gene Sequence: LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
• Gene ID - Mouse: ENSMUSG00000110777
• Gene ID - Rat: ENSRNOG00000019387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFI30 pAb (ATL-HPA026650 w/enhanced validation) – 2 Found

Xiang, Yu-Juan; Guo, Ming-Ming; Zhou, Cheng-Jun; Liu, Lu; Han, Bo; Kong, Ling-Yu; Gao, Zhong-Cheng; Ma, Zhong-Bing; Wang, Lu; Feng, Man; Chen, Hai-Ying; Jia, Guo-Tao; Gao, De-Zong; Zhang, Qiang; Li, Liang; Li, Yu-Yang; Yu, Zhi-Gang. Absence of gamma-interferon-inducible lysosomal thiol reductase (GILT) is associated with poor disease-free survival in breast cancer patients. Plos One. 9(10):e109449. 

Chen, Danying; Hou, Zhifei; Jiang, Dong; Zheng, Mei; Li, Guoli; Zhang, Yue; Li, Rui; Lin, Hanxin; Chang, Jinhong; Zeng, Hui; Guo, Ju-Tao; Zhao, Xuesen. GILT restricts the cellular entry mediated by the envelope glycoproteins of SARS-CoV, Ebola virus and Lassa fever virus. Emerging Microbes & Infections. 8(1):1511-1523.