Anti ICK pAb (ATL-HPA001113)

Atlas Antibodies

Catalog No.: ATL-HPA001113-25

Protein Description: intestinal cell (MAK-like) kinase
Gene Name: ICK
Alternative Gene Name: KIAA0936, LCK2, MGC46090, MRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009828: 66%, ENSRNOG00000008691: 63%
Entrez Gene ID: 22858
Uniprot ID: Q9UPZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRR
• Gene Sequence: VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRR
• Gene ID - Mouse: ENSMUSG00000009828
• Gene ID - Rat: ENSRNOG00000008691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ICK pAb (ATL-HPA001113) – 3 Found

Paige Taylor, S; Kunova Bosakova, Michaela; Varecha, Miroslav; Balek, Lukas; Barta, Tomas; Trantirek, Lukas; Jelinkova, Iva; Duran, Ivan; Vesela, Iva; Forlenza, Kimberly N; Martin, Jorge H; Hampl, Ales; Bamshad, Michael; Nickerson, Deborah; Jaworski, Margie L; Song, Jieun; Ko, Hyuk Wan; Cohn, Daniel H; Krakow, Deborah; Krejci, Pavel. An inactivating mutation in intestinal cell kinase, ICK, impairs hedgehog signalling and causes short rib-polydactyly syndrome. Human Molecular Genetics. 2016;25(18):3998-4011. 

Häggarth, Lars; Hägglöf, Christina; Jaraj, Sara Jonmarker; Wester, Kenneth; Pontén, Fredrik; Ostman, Arne; Egevad, Lars. Diagnostic biomarkers of prostate cancer. Scandinavian Journal Of Urology And Nephrology. 2011;45(1):60-7. 

Bosakova, Michaela; Abraham, Sara P; Nita, Alexandru; Hruba, Eva; Buchtova, Marcela; Taylor, S Paige; Duran, Ivan; Martin, Jorge; Svozilova, Katerina; Barta, Tomas; Varecha, Miroslav; Balek, Lukas; Kohoutek, Jiri; Radaszkiewicz, Tomasz; Pusapati, Ganesh V; Bryja, Vitezslav; Rush, Eric T; Thiffault, Isabelle; Nickerson, Deborah A; Bamshad, Michael J; Rohatgi, Rajat; Cohn, Daniel H; Krakow, Deborah; Krejci, Pavel. Mutations in GRK2 cause Jeune syndrome by impairing Hedgehog and canonical Wnt signaling. Embo Molecular Medicine. 2020;12(11):e11739.