Anti ICK pAb (ATL-HPA000791)

Atlas Antibodies

Catalog No.:
ATL-HPA000791-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: intestinal cell kinase
Gene Name: ICK
Alternative Gene Name: KIAA0936, LCK2, MGC46090, MRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009828: 81%, ENSRNOG00000008691: 80%
Entrez Gene ID: 22858
Uniprot ID: Q9UPZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS
Gene Sequence DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS
Gene ID - Mouse ENSMUSG00000009828
Gene ID - Rat ENSRNOG00000008691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ICK pAb (ATL-HPA000791)
Datasheet Anti ICK pAb (ATL-HPA000791) Datasheet (External Link)
Vendor Page Anti ICK pAb (ATL-HPA000791) at Atlas Antibodies

Documents & Links for Anti ICK pAb (ATL-HPA000791)
Datasheet Anti ICK pAb (ATL-HPA000791) Datasheet (External Link)
Vendor Page Anti ICK pAb (ATL-HPA000791)