Anti HUS1 pAb (ATL-HPA026787)

Atlas Antibodies

Catalog No.:
ATL-HPA026787-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: HUS1 checkpoint homolog (S. pombe)
Gene Name: HUS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020413: 91%, ENSRNOG00000005141: 92%
Entrez Gene ID: 3364
Uniprot ID: O60921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRASKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHD
Gene Sequence NHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRASKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHD
Gene ID - Mouse ENSMUSG00000020413
Gene ID - Rat ENSRNOG00000005141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HUS1 pAb (ATL-HPA026787)
Datasheet Anti HUS1 pAb (ATL-HPA026787) Datasheet (External Link)
Vendor Page Anti HUS1 pAb (ATL-HPA026787) at Atlas Antibodies

Documents & Links for Anti HUS1 pAb (ATL-HPA026787)
Datasheet Anti HUS1 pAb (ATL-HPA026787) Datasheet (External Link)
Vendor Page Anti HUS1 pAb (ATL-HPA026787)