Anti HTR4 pAb (ATL-HPA040591 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040591-25

Protein Description: 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled
Gene Name: HTR4
Alternative Gene Name: 5-HT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026322: 91%, ENSRNOG00000019134: 88%
Entrez Gene ID: 3360
Uniprot ID: Q13639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD
• Gene Sequence: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD
• Gene ID - Mouse: ENSMUSG00000026322
• Gene ID - Rat: ENSRNOG00000019134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HTR4 pAb (ATL-HPA040591 w/enhanced validation) – 1 Found

Wohlfarth, Carolin; Schmitteckert, Stefanie; Härtle, Janina D; Houghton, Lesley A; Dweep, Harsh; Fortea, Marina; Assadi, Ghazaleh; Braun, Alexander; Mederer, Tanja; Pöhner, Sarina; Becker, Philip P; Fischer, Christine; Granzow, Martin; Mönnikes, Hubert; Mayer, Emeran A; Sayuk, Gregory; Boeckxstaens, Guy; Wouters, Mira M; Simrén, Magnus; Lindberg, Greger; Ohlsson, Bodil; Schmidt, Peter Thelin; Dlugosz, Aldona; Agreus, Lars; Andreasson, Anna; D'Amato, Mauro; Burwinkel, Barbara; Bermejo, Justo Lorenzo; Röth, Ralph; Lasitschka, Felix; Vicario, Maria; Metzger, Marco; Santos, Javier; Rappold, Gudrun A; Martinez, Cristina; Niesler, Beate. miR-16 and miR-103 impact 5-HT(4) receptor signalling and correlate with symptom profile in irritable bowel syndrome. Scientific Reports. 2017;7(1):14680.