Anti HSPA6 pAb (ATL-HPA028549)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028549-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HSPA6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007033: 58%, ENSRNOG00000047966: 59%
Entrez Gene ID: 3310
Uniprot ID: P17066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG |
| Gene Sequence | EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG |
| Gene ID - Mouse | ENSMUSG00000007033 |
| Gene ID - Rat | ENSRNOG00000047966 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HSPA6 pAb (ATL-HPA028549) | |
| Datasheet | Anti HSPA6 pAb (ATL-HPA028549) Datasheet (External Link) |
| Vendor Page | Anti HSPA6 pAb (ATL-HPA028549) at Atlas Antibodies |
| Documents & Links for Anti HSPA6 pAb (ATL-HPA028549) | |
| Datasheet | Anti HSPA6 pAb (ATL-HPA028549) Datasheet (External Link) |
| Vendor Page | Anti HSPA6 pAb (ATL-HPA028549) |
| Citations for Anti HSPA6 pAb (ATL-HPA028549) – 3 Found |
| Wang, Xin; Mazurkiewicz, Magdalena; Hillert, Ellin-Kristina; Olofsson, Maria Hägg; Pierrou, Stefan; Hillertz, Per; Gullbo, Joachim; Selvaraju, Karthik; Paulus, Aneel; Akhtar, Sharoon; Bossler, Felicitas; Khan, Asher Chanan; Linder, Stig; D'Arcy, Padraig. The proteasome deubiquitinase inhibitor VLX1570 shows selectivity for ubiquitin-specific protease-14 and induces apoptosis of multiple myeloma cells. Scientific Reports. 2016;6( 27264969):26979. PubMed |
| Selvaraju, Karthik; Mofers, Arjan; Pellegrini, Paola; Salomonsson, Johannes; Ahlner, Alexandra; Morad, Vivian; Hillert, Ellin-Kristina; Espinosa, Belen; Arnér, Elias S J; Jensen, Lasse; Malmström, Jonas; Turkina, Maria V; D'Arcy, Padraig; Walters, Michael A; Sunnerhagen, Maria; Linder, Stig. Cytotoxic unsaturated electrophilic compounds commonly target the ubiquitin proteasome system. Scientific Reports. 2019;9(1):9841. PubMed |
| Mazurkiewicz, Magdalena; Hillert, Ellin-Kristina; Wang, Xin; Pellegrini, Paola; Olofsson, Maria Hägg; Selvaraju, Karthik; D'Arcy, Padraig; Linder, Stig. Acute lymphoblastic leukemia cells are sensitive to disturbances in protein homeostasis induced by proteasome deubiquitinase inhibition. Oncotarget. 2017;8(13):21115-21127. PubMed |