Anti HSPA6 pAb (ATL-HPA028549)

Atlas Antibodies

Catalog No.:
ATL-HPA028549-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: heat shock 70kDa protein 6 (HSP70B')
Gene Name: HSPA6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007033: 58%, ENSRNOG00000047966: 59%
Entrez Gene ID: 3310
Uniprot ID: P17066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG
Gene Sequence EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG
Gene ID - Mouse ENSMUSG00000007033
Gene ID - Rat ENSRNOG00000047966
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HSPA6 pAb (ATL-HPA028549)
Datasheet Anti HSPA6 pAb (ATL-HPA028549) Datasheet (External Link)
Vendor Page Anti HSPA6 pAb (ATL-HPA028549) at Atlas Antibodies

Documents & Links for Anti HSPA6 pAb (ATL-HPA028549)
Datasheet Anti HSPA6 pAb (ATL-HPA028549) Datasheet (External Link)
Vendor Page Anti HSPA6 pAb (ATL-HPA028549)
Citations for Anti HSPA6 pAb (ATL-HPA028549) – 3 Found
Wang, Xin; Mazurkiewicz, Magdalena; Hillert, Ellin-Kristina; Olofsson, Maria Hägg; Pierrou, Stefan; Hillertz, Per; Gullbo, Joachim; Selvaraju, Karthik; Paulus, Aneel; Akhtar, Sharoon; Bossler, Felicitas; Khan, Asher Chanan; Linder, Stig; D'Arcy, Padraig. The proteasome deubiquitinase inhibitor VLX1570 shows selectivity for ubiquitin-specific protease-14 and induces apoptosis of multiple myeloma cells. Scientific Reports. 2016;6( 27264969):26979.  PubMed
Selvaraju, Karthik; Mofers, Arjan; Pellegrini, Paola; Salomonsson, Johannes; Ahlner, Alexandra; Morad, Vivian; Hillert, Ellin-Kristina; Espinosa, Belen; Arnér, Elias S J; Jensen, Lasse; Malmström, Jonas; Turkina, Maria V; D'Arcy, Padraig; Walters, Michael A; Sunnerhagen, Maria; Linder, Stig. Cytotoxic unsaturated electrophilic compounds commonly target the ubiquitin proteasome system. Scientific Reports. 2019;9(1):9841.  PubMed
Mazurkiewicz, Magdalena; Hillert, Ellin-Kristina; Wang, Xin; Pellegrini, Paola; Olofsson, Maria Hägg; Selvaraju, Karthik; D'Arcy, Padraig; Linder, Stig. Acute lymphoblastic leukemia cells are sensitive to disturbances in protein homeostasis induced by proteasome deubiquitinase inhibition. Oncotarget. 2017;8(13):21115-21127.  PubMed