Anti HSPA12B pAb (ATL-HPA013659)

Atlas Antibodies

Catalog No.: ATL-HPA013659-25

Protein Description: heat shock 70kD protein 12B
Gene Name: HSPA12B
Alternative Gene Name: C20orf60, dJ1009E24.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074793: 86%, ENSRNOG00000021244: 87%
Entrez Gene ID: 116835
Uniprot ID: Q96MM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA
• Gene Sequence: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA
• Gene ID - Mouse: ENSMUSG00000074793
• Gene ID - Rat: ENSRNOG00000021244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.