Anti HSD3B1 pAb (ATL-HPA043264)

Atlas Antibodies

Catalog No.:
ATL-HPA043264-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Name: HSD3B1
Alternative Gene Name: HSD3B, HSDB3, SDR11E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063730: 84%, ENSRNOG00000042884: 89%
Entrez Gene ID: 3283
Uniprot ID: P14060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT
Gene Sequence RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT
Gene ID - Mouse ENSMUSG00000063730
Gene ID - Rat ENSRNOG00000042884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HSD3B1 pAb (ATL-HPA043264)
Datasheet Anti HSD3B1 pAb (ATL-HPA043264) Datasheet (External Link)
Vendor Page Anti HSD3B1 pAb (ATL-HPA043264) at Atlas Antibodies

Documents & Links for Anti HSD3B1 pAb (ATL-HPA043264)
Datasheet Anti HSD3B1 pAb (ATL-HPA043264) Datasheet (External Link)
Vendor Page Anti HSD3B1 pAb (ATL-HPA043264)