Anti HSD3B1 pAb (ATL-HPA043264)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043264-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HSD3B1
Alternative Gene Name: HSD3B, HSDB3, SDR11E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063730: 84%, ENSRNOG00000042884: 89%
Entrez Gene ID: 3283
Uniprot ID: P14060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT |
| Gene Sequence | RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT |
| Gene ID - Mouse | ENSMUSG00000063730 |
| Gene ID - Rat | ENSRNOG00000042884 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HSD3B1 pAb (ATL-HPA043264) | |
| Datasheet | Anti HSD3B1 pAb (ATL-HPA043264) Datasheet (External Link) |
| Vendor Page | Anti HSD3B1 pAb (ATL-HPA043264) at Atlas Antibodies |
| Documents & Links for Anti HSD3B1 pAb (ATL-HPA043264) | |
| Datasheet | Anti HSD3B1 pAb (ATL-HPA043264) Datasheet (External Link) |
| Vendor Page | Anti HSD3B1 pAb (ATL-HPA043264) |