Anti HS2ST1 pAb (ATL-HPA043603)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043603-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HS2ST1
Alternative Gene Name: KIAA0448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040151: 99%, ENSRNOG00000012549: 99%
Entrez Gene ID: 9653
Uniprot ID: Q7LGA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLE |
| Gene Sequence | LRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLE |
| Gene ID - Mouse | ENSMUSG00000040151 |
| Gene ID - Rat | ENSRNOG00000012549 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HS2ST1 pAb (ATL-HPA043603) | |
| Datasheet | Anti HS2ST1 pAb (ATL-HPA043603) Datasheet (External Link) |
| Vendor Page | Anti HS2ST1 pAb (ATL-HPA043603) at Atlas Antibodies |
| Documents & Links for Anti HS2ST1 pAb (ATL-HPA043603) | |
| Datasheet | Anti HS2ST1 pAb (ATL-HPA043603) Datasheet (External Link) |
| Vendor Page | Anti HS2ST1 pAb (ATL-HPA043603) |