Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028017-25

• 
• 
• 

Protein Description: glycogen synthase kinase 3 beta
Gene Name: GSK3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022812: 100%, ENSRNOG00000002833: 100%
Entrez Gene ID: 2932
Uniprot ID: P49841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS
• Gene Sequence: SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS
• Gene ID - Mouse: ENSMUSG00000022812
• Gene ID - Rat: ENSRNOG00000002833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.