Anti GOT2 pAb (ATL-HPA018139 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018139-25

• 
• 

Protein Description: glutamic-oxaloacetic transaminase 2, mitochondrial
Gene Name: GOT2
Alternative Gene Name: KAT4, KATIV, mitAAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031672: 95%, ENSRNOG00000011782: 95%
Entrez Gene ID: 2806
Uniprot ID: P00505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
• Gene Sequence: GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
• Gene ID - Mouse: ENSMUSG00000031672
• Gene ID - Rat: ENSRNOG00000011782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GOT2 pAb (ATL-HPA018139 w/enhanced validation) – 5 Found

Nelson, Barbara S; Lin, Lin; Kremer, Daniel M; Sousa, Cristovão M; Cotta-Ramusino, Cecilia; Myers, Amy; Ramos, Johanna; Gao, Tina; Kovalenko, Ilya; Wilder-Romans, Kari; Dresser, Joseph; Davis, Mary; Lee, Ho-Joon; Nwosu, Zeribe C; Campit, Scott; Mashadova, Oksana; Nicolay, Brandon N; Tolstyka, Zachary P; Halbrook, Christopher J; Chandrasekaran, Sriram; Asara, John M; Crawford, Howard C; Cantley, Lewis C; Kimmelman, Alec C; Wahl, Daniel R; Lyssiotis, Costas A. Tissue of origin dictates GOT1 dependence and confers synthetic lethality to radiotherapy. Cancer & Metabolism. 8( 31908776):1. 

Aleshin, Vasily A; Zhou, Xiaoshan; Krishnan, Shuba; Karlsson, Anna; Bunik, Victoria I. Interplay Between Thiamine and p53/p21 Axes Affects Antiproliferative Action of Cisplatin in Lung Adenocarcinoma Cells by Changing Metabolism of 2-Oxoglutarate/Glutamate. Frontiers In Genetics. 12( 33868388):658446. 

Kerk, Samuel A; Lin, Lin; Myers, Amy L; Sutton, Damien J; Andren, Anthony; Sajjakulnukit, Peter; Zhang, Li; Zhang, Yaqing; Jiménez, Jennifer A; Nelson, Barbara S; Chen, Brandon; Robinson, Anthony; Thurston, Galloway; Kemp, Samantha B; Steele, Nina G; Hoffman, Megan T; Wen, Hui-Ju; Long, Daniel; Ackenhusen, Sarah E; Ramos, Johanna; Gao, Xiaohua; Nwosu, Zeribe C; Galban, Stefanie; Halbrook, Christopher J; Lombard, David B; Piwnica-Worms, David R; Ying, Haoqiang; Pasca di Magliano, Marina; Crawford, Howard C; Shah, Yatrik M; Lyssiotis, Costas A. Metabolic requirement for GOT2 in pancreatic cancer depends on environmental context. Elife. 2022;11( 35815941) 

Abrego, Jaime; Sanford-Crane, Hannah; Oon, Chet; Xiao, Xu; Betts, Courtney B; Sun, Duanchen; Nagarajan, Shanthi; Diaz, Luis; Sandborg, Holly; Bhattacharyya, Sohinee; Xia, Zheng; Coussens, Lisa M; Tontonoz, Peter; Sherman, Mara H. A Cancer Cell-Intrinsic GOT2-PPARδ Axis Suppresses Antitumor Immunity. Cancer Discovery. 2022;12(10):2414-2433. 

Selen, Ebru S; Rodriguez, Susana; Cavagnini, Kyle S; Kim, Han-Byeol; Na, Chan Hyun; Wolfgang, Michael J. Requirement of hepatic pyruvate carboxylase during fasting, high fat, and ketogenic diet. The Journal Of Biological Chemistry. 2022;298(12):102648.