Anti GOLM1 pAb (ATL-HPA010638 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010638-25

• 
• 
• 

Protein Description: golgi membrane protein 1
Gene Name: GOLM1
Alternative Gene Name: bA379P1.3, C9orf155, FLJ23608, GOLPH2, GP73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021556: 46%, ENSRNOG00000018400: 45%
Entrez Gene ID: 51280
Uniprot ID: Q8NBJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
• Gene Sequence: GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
• Gene ID - Mouse: ENSMUSG00000021556
• Gene ID - Rat: ENSRNOG00000018400
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GOLM1 pAb (ATL-HPA010638 w/enhanced validation) – 5 Found

Zhou, Meiying; Chen, Xiaohong; Wu, Jian; He, Xiaoyan; Ren, Rui. MicroRNA-143 regulates cell migration and invasion by targeting GOLM1 in cervical cancer. Oncology Letters. 2018;16(5):6393-6400. 

Kojima, Satoko; Enokida, Hideki; Yoshino, Hirofumi; Itesako, Toshihiko; Chiyomaru, Takeshi; Kinoshita, Takashi; Fuse, Miki; Nishikawa, Rika; Goto, Yusuke; Naya, Yukio; Nakagawa, Masayuki; Seki, Naohiko. The tumor-suppressive microRNA-143/145 cluster inhibits cell migration and invasion by targeting GOLM1 in prostate cancer. Journal Of Human Genetics. 2014;59(2):78-87. 

Goto, Yusuke; Kojima, Satoko; Nishikawa, Rika; Enokida, Hideki; Chiyomaru, Takeshi; Kinoshita, Takashi; Nakagawa, Masayuki; Naya, Yukio; Ichikawa, Tomohiko; Seki, Naohiko. The microRNA-23b/27b/24-1 cluster is a disease progression marker and tumor suppressor in prostate cancer. Oncotarget. 2014;5(17):7748-59. 

Exarchos, Vasileios; Neuber, Sebastian; Meyborg, Heike; Giampietro, Costanza; Chala, Nafsika; Moimas, Silvia; Hinkov, Hristian; Kaufmann, Friedrich; Pramotton, Francesca M; Krüger, Katrin; Rodriguez Cetina Biefer, Hector; Cesarovic, Nikola; Poulikakos, Dimos; Falk, Volkmar; Emmert, Maximilian Y; Ferrari, Aldo; Nazari-Shafti, Timo Z. Anisotropic topographies restore endothelial monolayer integrity and promote the proliferation of senescent endothelial cells. Frontiers In Cardiovascular Medicine. 9( 36277782):953582. 

Bongolo, Christian Cedric; Thokerunga, Erick; Yan, Qian; Yacouba, Mohamed Bassirou Moukeila; Wang, Chao. Exosomes Derived from microRNA-27a-3p Overexpressing Mesenchymal Stem Cells Inhibit the Progression of Liver Cancer through Suppression of Golgi Membrane Protein 1. Stem Cells International. 2022( 36530488):9748714.