Anti FMNL2 pAb (ATL-HPA005464 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005464-25

Protein Description: formin-like 2
Gene Name: FMNL2
Alternative Gene Name: FHOD2, KIAA1902
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036053: 94%, ENSRNOG00000055567: 95%
Entrez Gene ID: 114793
Uniprot ID: Q96PY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
• Gene Sequence: ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
• Gene ID - Mouse: ENSMUSG00000036053
• Gene ID - Rat: ENSRNOG00000055567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FMNL2 pAb (ATL-HPA005464 w/enhanced validation) – 3 Found

Grobe, Hanna; Wüstenhagen, Andrea; Baarlink, Christian; Grosse, Robert; Grikscheit, Katharina. A Rac1-FMNL2 signaling module affects cell-cell contact formation independent of Cdc42 and membrane protrusions. Plos One. 13(3):e0194716. 

Gardberg, Maria; Talvinen, Kati; Kaipio, Katja; Iljin, Kristiina; Kampf, Caroline; Uhlen, Mathias; Carpén, Olli. Characterization of Diaphanous-related formin FMNL2 in human tissues. Bmc Cell Biology. 2010;11( 20633255):55. 

Grikscheit, Katharina; Frank, Tanja; Wang, Ying; Grosse, Robert. Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1. The Journal Of Cell Biology. 2015;209(3):367-76.