Anti EXOC6B pAb (ATL-HPA034546)

Atlas Antibodies

SKU: ATL-HPA034546-25

• 
• 

Protein Description: exocyst complex component 6B
Gene Name: EXOC6B
Alternative Gene Name: KIAA0919, SEC15B, SEC15L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033769: 93%, ENSRNOG00000059615: 93%
Entrez Gene ID: 23233
Uniprot ID: Q9Y2D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKQAQQQRNLDNIVLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQDSGILDVEDEE
• Gene Sequence: MKQAQQQRNLDNIVLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQDSGILDVEDEE
• Gene ID - Mouse: ENSMUSG00000033769
• Gene ID - Rat: ENSRNOG00000059615
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.