Anti ENDOD1 pAb (ATL-HPA008932 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008932-25

Protein Description: endonuclease domain containing 1
Gene Name: ENDOD1
Alternative Gene Name: KIAA0830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037419: 74%, ENSRNOG00000024757: 77%
Entrez Gene ID: 23052
Uniprot ID: O94919
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPF
• Gene Sequence: SGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPF
• Gene ID - Mouse: ENSMUSG00000037419
• Gene ID - Rat: ENSRNOG00000024757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.