Anti ELF5 pAb (ATL-HPA062706)

Atlas Antibodies

Catalog No.: ATL-HPA062706-25

Protein Description: E74-like factor 5 (ets domain transcription factor)
Gene Name: ELF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027186: 96%, ENSRNOG00000058235: 100%
Entrez Gene ID: 2001
Uniprot ID: Q9UKW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW
• Gene Sequence: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW
• Gene ID - Mouse: ENSMUSG00000027186
• Gene ID - Rat: ENSRNOG00000058235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.