Anti ZRANB1 pAb (ATL-HPA029239)

Atlas Antibodies

Catalog No.:
ATL-HPA029239-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger, RAN-binding domain containing 1
Gene Name: ZRANB1
Alternative Gene Name: TRABID
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030967: 98%, ENSRNOG00000017294: 98%
Entrez Gene ID: 54764
Uniprot ID: Q9UGI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
Gene Sequence SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
Gene ID - Mouse ENSMUSG00000030967
Gene ID - Rat ENSRNOG00000017294
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZRANB1 pAb (ATL-HPA029239)
Datasheet Anti ZRANB1 pAb (ATL-HPA029239) Datasheet (External Link)
Vendor Page Anti ZRANB1 pAb (ATL-HPA029239) at Atlas Antibodies

Documents & Links for Anti ZRANB1 pAb (ATL-HPA029239)
Datasheet Anti ZRANB1 pAb (ATL-HPA029239) Datasheet (External Link)
Vendor Page Anti ZRANB1 pAb (ATL-HPA029239)