Anti ZNF586 pAb (ATL-HPA030306)

Atlas Antibodies

Catalog No.: ATL-HPA030306-25

Protein Description: zinc finger protein 586
Gene Name: ZNF586
Alternative Gene Name: FLJ20070
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 34%, ENSRNOG00000047132: 34%
Entrez Gene ID: 54807
Uniprot ID: Q9NXT0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLETLTLISSLGCWHGGEDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTG
• Gene Sequence: MLETLTLISSLGCWHGGEDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTG
• Gene ID - Mouse: ENSMUSG00000054737
• Gene ID - Rat: ENSRNOG00000047132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.