Anti ZNF461 pAb (ATL-HPA021139)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021139-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF461
Alternative Gene Name: GIOT-1, MGC33911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078768: 28%, ENSRNOG00000051494: 33%
Entrez Gene ID: 92283
Uniprot ID: Q8TAF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ |
| Gene Sequence | NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ |
| Gene ID - Mouse | ENSMUSG00000078768 |
| Gene ID - Rat | ENSRNOG00000051494 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF461 pAb (ATL-HPA021139) | |
| Datasheet | Anti ZNF461 pAb (ATL-HPA021139) Datasheet (External Link) |
| Vendor Page | Anti ZNF461 pAb (ATL-HPA021139) at Atlas Antibodies |
| Documents & Links for Anti ZNF461 pAb (ATL-HPA021139) | |
| Datasheet | Anti ZNF461 pAb (ATL-HPA021139) Datasheet (External Link) |
| Vendor Page | Anti ZNF461 pAb (ATL-HPA021139) |