Anti ZNF461 pAb (ATL-HPA021139)

Atlas Antibodies

Catalog No.: ATL-HPA021139-25

Protein Description: zinc finger protein 461
Gene Name: ZNF461
Alternative Gene Name: GIOT-1, MGC33911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078768: 28%, ENSRNOG00000051494: 33%
Entrez Gene ID: 92283
Uniprot ID: Q8TAF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ
• Gene Sequence: NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ
• Gene ID - Mouse: ENSMUSG00000078768
• Gene ID - Rat: ENSRNOG00000051494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.