Protein Description: YLP motif containing 1
Gene Name: YLPM1
Alternative Gene Name: C14orf170, PPP1R169, ZAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021244: 85%, ENSRNOG00000027317: 84%
Entrez Gene ID: 56252
Uniprot ID: P49750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQST
Gene Sequence SGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQST
Gene ID - Mouse ENSMUSG00000021244
Gene ID - Rat ENSRNOG00000027317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation)
Datasheet Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation)
Datasheet Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation)