Anti YLPM1 pAb (ATL-HPA048070)

Atlas Antibodies

Catalog No.: ATL-HPA048070-25

Protein Description: YLP motif containing 1
Gene Name: YLPM1
Alternative Gene Name: C14orf170, PPP1R169, ZAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021244: 99%, ENSRNOG00000027317: 97%
Entrez Gene ID: 56252
Uniprot ID: P49750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDRGELRIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKA
• Gene Sequence: RDRGELRIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKA
• Gene ID - Mouse: ENSMUSG00000021244
• Gene ID - Rat: ENSRNOG00000027317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.