Anti YLPM1 pAb (ATL-HPA048070)

Atlas Antibodies

Catalog No.:
ATL-HPA048070-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: YLP motif containing 1
Gene Name: YLPM1
Alternative Gene Name: C14orf170, PPP1R169, ZAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021244: 99%, ENSRNOG00000027317: 97%
Entrez Gene ID: 56252
Uniprot ID: P49750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDRGELRIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKA
Gene Sequence RDRGELRIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKA
Gene ID - Mouse ENSMUSG00000021244
Gene ID - Rat ENSRNOG00000027317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YLPM1 pAb (ATL-HPA048070)
Datasheet Anti YLPM1 pAb (ATL-HPA048070) Datasheet (External Link)
Vendor Page Anti YLPM1 pAb (ATL-HPA048070) at Atlas Antibodies

Documents & Links for Anti YLPM1 pAb (ATL-HPA048070)
Datasheet Anti YLPM1 pAb (ATL-HPA048070) Datasheet (External Link)
Vendor Page Anti YLPM1 pAb (ATL-HPA048070)