Anti VIP pAb (ATL-HPA017324)

Atlas Antibodies

Catalog No.: ATL-HPA017324-25

Protein Description: vasoactive intestinal peptide
Gene Name: VIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019772: 86%, ENSRNOG00000018808: 89%
Entrez Gene ID: 7432
Uniprot ID: P01282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE
• Gene Sequence: EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE
• Gene ID - Mouse: ENSMUSG00000019772
• Gene ID - Rat: ENSRNOG00000018808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VIP pAb (ATL-HPA017324) – 1 Found

Dedeene, Lieselot; Van Schoor, Evelien; Vandenberghe, Rik; Van Damme, Philip; Poesen, Koen; Thal, Dietmar Rudolf. Circadian sleep/wake-associated cells show dipeptide repeat protein aggregates in C9orf72-related ALS and FTLD cases. Acta Neuropathologica Communications. 2019;7(1):189.