Anti VEZF1 pAb (ATL-HPA027520)

Atlas Antibodies

Catalog No.: ATL-HPA027520-25

Protein Description: vascular endothelial zinc finger 1
Gene Name: VEZF1
Alternative Gene Name: DB1, ZNF161
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098546: 99%, ENSRNOG00000009819: 99%
Entrez Gene ID: 7716
Uniprot ID: Q14119
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
• Gene Sequence: RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
• Gene ID - Mouse: ENSMUSG00000098546
• Gene ID - Rat: ENSRNOG00000009819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.