Anti UNC45B pAb (ATL-HPA017861)

Atlas Antibodies

Catalog No.: ATL-HPA017861-25

Protein Description: unc-45 homolog B (C. elegans)
Gene Name: UNC45B
Alternative Gene Name: CMYA4, UNC45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018845: 93%, ENSRNOG00000009466: 92%
Entrez Gene ID: 146862
Uniprot ID: Q8IWX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEDDDKVQNAAAGALAMLTAAHKKLCLKMTQVTTQWLEILQRLCLHDQLSVQHRGLVIAYNLLAADAELAKKLVESELLEILTVVGKQEPDEKKAEVVQTARECLIKCMDYGFI
• Gene Sequence: GEDDDKVQNAAAGALAMLTAAHKKLCLKMTQVTTQWLEILQRLCLHDQLSVQHRGLVIAYNLLAADAELAKKLVESELLEILTVVGKQEPDEKKAEVVQTARECLIKCMDYGFI
• Gene ID - Mouse: ENSMUSG00000018845
• Gene ID - Rat: ENSRNOG00000009466
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UNC45B pAb (ATL-HPA017861) – 2 Found

Hellerschmied, Doris; Roessler, Max; Lehner, Anita; Gazda, Linn; Stejskal, Karel; Imre, Richard; Mechtler, Karl; Dammermann, Alexander; Clausen, Tim. UFD-2 is an adaptor-assisted E3 ligase targeting unfolded proteins. Nature Communications. 2018;9(1):484. 

Lehtimäki, Jaakko I; Fenix, Aidan M; Kotila, Tommi M; Balistreri, Giuseppe; Paavolainen, Lassi; Varjosalo, Markku; Burnette, Dylan T; Lappalainen, Pekka. UNC-45a promotes myosin folding and stress fiber assembly. The Journal Of Cell Biology. 2017;216(12):4053-4072.