Anti UHRF2 pAb (ATL-HPA026633)

Atlas Antibodies

Catalog No.: ATL-HPA026633-25

Protein Description: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Gene Name: UHRF2
Alternative Gene Name: MGC33463, NIRF, RNF107, URF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024817: 81%, ENSRNOG00000011308: 81%
Entrez Gene ID: 115426
Uniprot ID: Q96PU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA
• Gene Sequence: SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA
• Gene ID - Mouse: ENSMUSG00000024817
• Gene ID - Rat: ENSRNOG00000011308
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UHRF2 pAb (ATL-HPA026633) – 1 Found

Lu, Huarui; Bhoopatiraju, Sweta; Wang, Hongbo; Schmitz, Nolan P; Wang, Xiaohong; Freeman, Matthew J; Forster, Colleen L; Verneris, Michael R; Linden, Michael A; Hallstrom, Timothy C. Loss of UHRF2 expression is associated with human neoplasia, promoter hypermethylation, decreased 5-hydroxymethylcytosine, and high proliferative activity. Oncotarget. 2016;7(46):76047-76061.