Anti UBE2J1 pAb (ATL-HPA003509 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003509-25

Protein Description: ubiquitin-conjugating enzyme E2, J1
Gene Name: UBE2J1
Alternative Gene Name: CGI-76, HSPC153, NCUBE1, UBC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028277: 82%, ENSRNOG00000007434: 40%
Entrez Gene ID: 51465
Uniprot ID: Q9Y385
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
• Gene Sequence: VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
• Gene ID - Mouse: ENSMUSG00000028277
• Gene ID - Rat: ENSRNOG00000007434
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.