Anti TSTD1 pAb (ATL-HPA006655)

Atlas Antibodies

Catalog No.: ATL-HPA006655-25

Protein Description: thiosulfate sulfurtransferase (rhodanese)-like domain containing 1
Gene Name: TSTD1
Alternative Gene Name: KAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103711: 82%, ENSRNOG00000047123: 81%
Entrez Gene ID: 100131187
Uniprot ID: Q8NFU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG
• Gene Sequence: MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG
• Gene ID - Mouse: ENSMUSG00000103711
• Gene ID - Rat: ENSRNOG00000047123
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TSTD1 pAb (ATL-HPA006655) – 1 Found

Ansar, Muhamad; Thu, Le Thi Anh; Hung, Chin-Sheng; Su, Chih-Ming; Huang, Man-Hsu; Liao, Li-Min; Chung, Yu-Mei; Lin, Ruo-Kai. Promoter hypomethylation and overexpression of TSTD1 mediate poor treatment response in breast cancer. Frontiers In Oncology. 12( 36419875):1004261.