Anti TRIT1 pAb (ATL-HPA024174)

Atlas Antibodies

Catalog No.: ATL-HPA024174-25

Protein Description: tRNA isopentenyltransferase 1
Gene Name: TRIT1
Alternative Gene Name: FLJ20061, IPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028653: 83%, ENSRNOG00000014274: 80%
Entrez Gene ID: 54802
Uniprot ID: Q9H3H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDH
• Gene Sequence: LEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDH
• Gene ID - Mouse: ENSMUSG00000028653
• Gene ID - Rat: ENSRNOG00000014274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.