Anti TRIOBP pAb (ATL-HPA019769 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019769-25

Protein Description: TRIO and F-actin binding protein
Gene Name: TRIOBP
Alternative Gene Name: DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033088: 83%, ENSRNOG00000059015: 85%
Entrez Gene ID: 11078
Uniprot ID: Q9H2D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
• Gene Sequence: ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
• Gene ID - Mouse: ENSMUSG00000033088
• Gene ID - Rat: ENSRNOG00000059015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIOBP pAb (ATL-HPA019769 w/enhanced validation) – 4 Found

Bradshaw, Nicholas J; Yerabham, Antony S K; Marreiros, Rita; Zhang, Tao; Nagel-Steger, Luitgard; Korth, Carsten. An unpredicted aggregation-critical region of the actin-polymerizing protein TRIOBP-1/Tara, determined by elucidation of its domain structure. The Journal Of Biological Chemistry. 2017;292(23):9583-9598. 

Bradshaw, Nicholas J; Ukkola-Vuoti, Liisa; Pankakoski, Maiju; Zheutlin, Amanda B; Ortega-Alonso, Alfredo; Torniainen-Holm, Minna; Sinha, Vishal; Therman, Sebastian; Paunio, Tiina; Suvisaari, Jaana; Lönnqvist, Jouko; Cannon, Tyrone D; Haukka, Jari; Hennah, William. The NDE1 genomic locus can affect treatment of psychiatric illness through gene expression changes related to microRNA-484. Open Biology. 2017;7(11) 

Lee, Sungsu; Song, Jae-Jun; Beyer, Lisa A; Swiderski, Donald L; Prieskorn, Diane M; Acar, Melih; Jen, Hsin-I; Groves, Andrew K; Raphael, Yehoash. Combinatorial Atoh1 and Gfi1 induction enhances hair cell regeneration in the adult cochlea. Scientific Reports. 2020;10(1):21397. 

Samardžija, Bobana; Pavešić Radonja, Aristea; Zaharija, Beti; Bergman, Mihaela; Renner, Éva; Palkovits, Miklós; Rubeša, Gordana; Bradshaw, Nicholas J. Protein Aggregation of NPAS3, Implicated in Mental Illness, Is Not Limited to the V304I Mutation. Journal Of Personalized Medicine. 2021;11(11)