Anti TRIOBP pAb (ATL-HPA003747 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003747-25

Protein Description: TRIO and F-actin binding protein
Gene Name: TRIOBP
Alternative Gene Name: DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033088: 92%, ENSRNOG00000059015: 91%
Entrez Gene ID: 11078
Uniprot ID: Q9H2D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL
• Gene Sequence: EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL
• Gene ID - Mouse: ENSMUSG00000033088
• Gene ID - Rat: ENSRNOG00000059015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIOBP pAb (ATL-HPA003747 w/enhanced validation) – 2 Found

Bradshaw, Nicholas J; Yerabham, Antony S K; Marreiros, Rita; Zhang, Tao; Nagel-Steger, Luitgard; Korth, Carsten. An unpredicted aggregation-critical region of the actin-polymerizing protein TRIOBP-1/Tara, determined by elucidation of its domain structure. The Journal Of Biological Chemistry. 2017;292(23):9583-9598. 

Bradshaw, Nicholas J; Bader, Verian; Prikulis, Ingrid; Lueking, Angelika; Müllner, Stefan; Korth, Carsten. Aggregation of the protein TRIOBP-1 and its potential relevance to schizophrenia. Plos One. 9(10):e111196.