Anti TMBIM1 pAb (ATL-HPA012093)

Atlas Antibodies

Catalog No.: ATL-HPA012093-25

Protein Description: transmembrane BAX inhibitor motif containing 1
Gene Name: TMBIM1
Alternative Gene Name: LFG3, PP1201, RECS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006301: 85%, ENSRNOG00000014797: 88%
Entrez Gene ID: 64114
Uniprot ID: Q969X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT
• Gene Sequence: GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT
• Gene ID - Mouse: ENSMUSG00000006301
• Gene ID - Rat: ENSRNOG00000014797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.