Anti TM7SF2 pAb (ATL-HPA030691)

Atlas Antibodies

Catalog No.: ATL-HPA030691-25

Protein Description: transmembrane 7 superfamily member 2
Gene Name: TM7SF2
Alternative Gene Name: ANG1, DHCR14A, NET47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024799: 89%, ENSRNOG00000020989: 89%
Entrez Gene ID: 7108
Uniprot ID: O76062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVAPVSALAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTM
• Gene Sequence: QVAPVSALAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTM
• Gene ID - Mouse: ENSMUSG00000024799
• Gene ID - Rat: ENSRNOG00000020989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.