Anti TET1 pAb (ATL-HPA019032)

Atlas Antibodies

Catalog No.: ATL-HPA019032-25

Protein Description: tet methylcytosine dioxygenase 1
Gene Name: TET1
Alternative Gene Name: bA119F7.1, CXXC6, KIAA1676, LCX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047146: 46%, ENSRNOG00000000277: 47%
Entrez Gene ID: 80312
Uniprot ID: Q8NFU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
• Gene Sequence: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
• Gene ID - Mouse: ENSMUSG00000047146
• Gene ID - Rat: ENSRNOG00000000277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TET1 pAb (ATL-HPA019032) – 6 Found

Zhao, Xiao-Qian; Zhang, Yi-Fei; Xia, Yi-Fang; Zhou, Zhong-Mei; Cao, Ying-Qing. Promoter demethylation of nuclear factor-erythroid 2-related factor 2 gene in drug-resistant colon cancer cells. Oncology Letters. 2015;10(3):1287-1292. 

Barazeghi, Elham; Prabhawa, Surendra; Norlén, Olov; Hellman, Per; Stålberg, Peter; Westin, Gunnar. Decrease of 5-hydroxymethylcytosine and TET1 with nuclear exclusion of TET2 in small intestinal neuroendocrine tumors. Bmc Cancer. 2018;18(1):764. 

Wu, Shuang-Ling; Zhang, Xiaoyi; Chang, Mengqi; Huang, Changcai; Qian, Jun; Li, Qing; Yuan, Fang; Sun, Lihong; Yu, Xinmiao; Cui, Xinmiao; Jiang, Jiayi; Cui, Mengyao; Liu, Ye; Wu, Huan-Wen; Liang, Zhi-Yong; Wang, Xiaoyue; Niu, Yamei; Tong, Wei-Min; Jin, Feng. Genome-wide 5-Hydroxymethylcytosine Profiling Analysis Identifies MAP7D1 as A Novel Regulator of Lymph Node Metastasis in Breast Cancer. Genomics, Proteomics & Bioinformatics. 2021;19(1):64-79. 

Barazeghi, Elham; Gill, Anthony J; Sidhu, Stan; Norlén, Olov; Dina, Roberto; Palazzo, F Fausto; Hellman, Per; Stålberg, Peter; Westin, Gunnar. 5-Hydroxymethylcytosine discriminates between parathyroid adenoma and carcinoma. Clinical Epigenetics. 8( 26973719):31. 

Yan, Fei; Zhao, Wei; Xu, Xiaoyue; Li, Chenchen; Li, Xiaoyou; Liu, Siwen; Shi, Lin; Wu, Yuan. LncRNA DHRS4-AS1 Inhibits the Stemness of NSCLC Cells by Sponging miR-224-3p and Upregulating TP53 and TET1. Frontiers In Cell And Developmental Biology. 8( 33425890):585251. 

Zhao, Fu; Zhang, Zhi-Wei; Zhang, Jing; Zhang, Shun; Zhang, Heng; Zhao, Chi; Chen, Yang; Luo, Lin; Tong, Wei-Min; Li, Chunde; Niu, Yamei; Liu, Pinan. Loss of 5-Hydroxymethylcytosine as an Epigenetic Signature That Correlates With Poor Outcomes in Patients With Medulloblastoma. Frontiers In Oncology. 11( 33718152):603686.