Anti TBCE pAb (ATL-HPA026557 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026557-25

Protein Description: tubulin folding cofactor E
Gene Name: TBCE
Alternative Gene Name: HRD, KCS, KCS1, pac2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039233: 82%, ENSRNOG00000029667: 85%
Entrez Gene ID: 6905
Uniprot ID: Q15813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
• Gene Sequence: DWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
• Gene ID - Mouse: ENSMUSG00000039233
• Gene ID - Rat: ENSRNOG00000029667
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.