Anti SYNE1 pAb (ATL-HPA019113)

Atlas Antibodies

Catalog No.: ATL-HPA019113-25

Protein Description: spectrin repeat containing, nuclear envelope 1
Gene Name: SYNE1
Alternative Gene Name: 8B, ARCA1, C6orf98, CPG2, dJ45H2.2, enaptin, KIAA0796, MYNE1, Nesp1, Nesprin-1, SCAR8, SYNE-1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096054: 86%, ENSRNOG00000026319: 26%
Entrez Gene ID: 23345
Uniprot ID: Q8NF91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
• Gene Sequence: SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
• Gene ID - Mouse: ENSMUSG00000096054
• Gene ID - Rat: ENSRNOG00000026319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYNE1 pAb (ATL-HPA019113) – 2 Found

Göb, Eva; Schmitt, Johannes; Benavente, Ricardo; Alsheimer, Manfred. Mammalian sperm head formation involves different polarization of two novel LINC complexes. Plos One. 2010;5(8):e12072. 

Nastały, Paulina; Purushothaman, Divya; Marchesi, Stefano; Poli, Alessandro; Lendenmann, Tobias; Kidiyoor, Gururaj Rao; Beznoussenko, Galina V; Lavore, Stefania; Romano, Orso Maria; Poulikakos, Dimos; Lagomarsino, Marco Cosentino; Mironov, Alexander A; Ferrari, Aldo; Maiuri, Paolo. Role of the nuclear membrane protein Emerin in front-rear polarity of the nucleus. Nature Communications. 2020;11(1):2122.