Anti STEAP2 pAb (ATL-HPA029115)

Atlas Antibodies

Catalog No.: ATL-HPA029115-25

Protein Description: STEAP family member 2, metalloreductase
Gene Name: STEAP2
Alternative Gene Name: IPCA-1, PCANAP1, STAMP1, STMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015653: 96%, ENSRNOG00000006076: 96%
Entrez Gene ID: 261729
Uniprot ID: Q8NFT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
• Gene Sequence: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
• Gene ID - Mouse: ENSMUSG00000015653
• Gene ID - Rat: ENSRNOG00000006076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.