Anti SPATA32 pAb (ATL-HPA024549)

Atlas Antibodies

Catalog No.: ATL-HPA024549-25

Protein Description: spermatogenesis associated 32
Gene Name: SPATA32
Alternative Gene Name: AEP2, C17orf46, FLJ25414, TEX34, VAD1.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044787: 37%, ENSRNOG00000003275: 39%
Entrez Gene ID: 124783
Uniprot ID: Q96LK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPL
• Gene Sequence: SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPL
• Gene ID - Mouse: ENSMUSG00000044787
• Gene ID - Rat: ENSRNOG00000003275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.