Anti SMIM20 pAb (ATL-HPA016552)

Atlas Antibodies

Catalog No.: ATL-HPA016552-25

Protein Description: small integral membrane protein 20
Gene Name: SMIM20
Alternative Gene Name: C4orf52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061461: 95%, ENSRNOG00000049758: 37%
Entrez Gene ID: 389203
Uniprot ID: Q8N5G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
• Gene Sequence: LMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
• Gene ID - Mouse: ENSMUSG00000061461
• Gene ID - Rat: ENSRNOG00000049758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMIM20 pAb (ATL-HPA016552) – 1 Found

Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494.