Anti SLC7A1 pAb (ATL-HPA039721)

Atlas Antibodies

Catalog No.: ATL-HPA039721-100

Protein Description: solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
Gene Name: SLC7A1
Alternative Gene Name: ATRC1, CAT-1, ERR, HCAT1, REC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041313: 75%, ENSRNOG00000000924: 79%
Entrez Gene ID: 6541
Uniprot ID: P30825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
• Gene Sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
• Gene ID - Mouse: ENSMUSG00000041313
• Gene ID - Rat: ENSRNOG00000000924
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.