Anti SLC30A1 pAb (ATL-HPA015275)

Atlas Antibodies

Catalog No.:
ATL-HPA015275-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 30 (zinc transporter), member 1
Gene Name: SLC30A1
Alternative Gene Name: ZNT1, ZRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110850: 64%, ENSRNOG00000004749: 66%
Entrez Gene ID: 7779
Uniprot ID: Q9Y6M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
Gene Sequence HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
Gene ID - Mouse ENSMUSG00000110850
Gene ID - Rat ENSRNOG00000004749
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC30A1 pAb (ATL-HPA015275)
Datasheet Anti SLC30A1 pAb (ATL-HPA015275) Datasheet (External Link)
Vendor Page Anti SLC30A1 pAb (ATL-HPA015275) at Atlas Antibodies

Documents & Links for Anti SLC30A1 pAb (ATL-HPA015275)
Datasheet Anti SLC30A1 pAb (ATL-HPA015275) Datasheet (External Link)
Vendor Page Anti SLC30A1 pAb (ATL-HPA015275)