Anti SLC2A3 pAb (ATL-HPA006539)

Atlas Antibodies

Catalog No.: ATL-HPA006539-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 3
Gene Name: SLC2A3
Alternative Gene Name: GLUT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003153: 65%, ENSRNOG00000008376: 64%
Entrez Gene ID: 6515
Uniprot ID: P11169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
• Gene Sequence: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
• Gene ID - Mouse: ENSMUSG00000003153
• Gene ID - Rat: ENSRNOG00000008376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC2A3 pAb (ATL-HPA006539) – 5 Found

Munthe, Sune; Petterson, Stine Asferg; Dahlrot, Rikke Hedegaard; Poulsen, Frantz Rom; Hansen, Steinbjørn; Kristensen, Bjarne Winther. Glioma Cells in the Tumor Periphery Have a Stem Cell Phenotype. Plos One. 11(5):e0155106. 

Wang, Wenqi; Xiao, Zhen-Dong; Li, Xu; Aziz, Kathryn E; Gan, Boyi; Johnson, Randy L; Chen, Junjie. AMPK modulates Hippo pathway activity to regulate energy homeostasis. Nature Cell Biology. 2015;17(4):490-9. 

O'Hagan, Steve; Wright Muelas, Marina; Day, Philip J; Lundberg, Emma; Kell, Douglas B. GeneGini: Assessment via the Gini Coefficient of Reference "Housekeeping" Genes and Diverse Human Transporter Expression Profiles. Cell Systems. 2018;6(2):230-244.e1. 

Osumi, Hironobu; Horiguchi, Haruki; Kadomatsu, Tsuyoshi; Tashiro, Kyosei; Morinaga, Jun; Takahashi, Takashi; Ikeda, Koei; Ito, Takaaki; Suzuki, Makoto; Endo, Motoyoshi; Oike, Yuichi. Tumor cell-derived angiopoietin-like protein 2 establishes a preference for glycolytic metabolism in lung cancer cells. Cancer Science. 2020;111(4):1241-1253. 

Hagiwara, Akifumi; Yao, Jingwen; Raymond, Catalina; Cho, Nicholas S; Everson, Richard; Patel, Kunal; Morrow, Danielle H; Desousa, Brandon R; Mareninov, Sergey; Chun, Saewon; Nathanson, David A; Yong, William H; Andrei, Gafita; Divakaruni, Ajit S; Salamon, Noriko; Pope, Whitney B; Nghiemphu, Phioanh L; Liau, Linda M; Cloughesy, Timothy F; Ellingson, Benjamin M. "Aerobic glycolytic imaging" of human gliomas using combined pH-, oxygen-, and perfusion-weighted magnetic resonance imaging. Neuroimage. Clinical. 32( 34911188):102882.