Anti SLC13A2 pAb (ATL-HPA014963 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014963-25

Protein Description: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Gene Name: SLC13A2
Alternative Gene Name: NaDC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001095: 67%, ENSRNOG00000010337: 71%
Entrez Gene ID: 9058
Uniprot ID: Q13183
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
• Gene Sequence: ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
• Gene ID - Mouse: ENSMUSG00000001095
• Gene ID - Rat: ENSRNOG00000010337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC13A2 pAb (ATL-HPA014963 w/enhanced validation) – 1 Found

Hall, Adam E; Pohl, Sebastian Öther-Gee; Cammareri, Patrizia; Aitken, Stuart; Younger, Nicholas T; Raponi, Michela; Billard, Caroline V; Carrancio, Alfonso Bolado; Bastem, Aslihan; Freile, Paz; Haward, Fiona; Adams, Ian R; Caceres, Javier F; Preyzner, Paula; von Kriegsheim, Alex; Dunlop, Malcolm G; Din, Farhat V; Myant, Kevin B. RNA splicing is a key mediator of tumour cell plasticity and a therapeutic vulnerability in colorectal cancer. Nature Communications. 2022;13(1):2791.