Anti SLC10A5 pAb (ATL-HPA025966)

Atlas Antibodies

Catalog No.: ATL-HPA025966-100

Protein Description: solute carrier family 10, member 5
Gene Name: SLC10A5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058921: 69%, ENSRNOG00000032426: 66%
Entrez Gene ID: 347051
Uniprot ID: Q5PT55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL
• Gene Sequence: GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL
• Gene ID - Mouse: ENSMUSG00000058921
• Gene ID - Rat: ENSRNOG00000032426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.