Anti SI pAb (ATL-HPA011897 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011897-25

Protein Description: sucrase-isomaltase (alpha-glucosidase)
Gene Name: SI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027790: 61%, ENSRNOG00000031067: 63%
Entrez Gene ID: 6476
Uniprot ID: P14410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYV
• Gene Sequence: PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYV
• Gene ID - Mouse: ENSMUSG00000027790
• Gene ID - Rat: ENSRNOG00000031067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SI pAb (ATL-HPA011897 w/enhanced validation) – 5 Found

Haberman, Yael; Di Segni, Ayelet; Loberman-Nachum, Nurit; Barel, Ortal; Kunik, Vered; Eyal, Eran; Kol, Nitzan; Hout-Siloni, Goni; Kochavi, Brigitte; Avivi, Camila; Schvimer, Michael; Rechavi, Gideon; Anikster, Yair; Barshack, Iris; Weiss, Batia. Congenital Sucrase-isomaltase Deficiency: A Novel Compound Heterozygous Mutation Causing Aberrant Protein Localization. Journal Of Pediatric Gastroenterology And Nutrition. 2017;64(5):770-776. 

Krishnan, Moorthy; Lapierre, Lynne A; Knowles, Byron C; Goldenring, James R. Rab25 regulates integrin expression in polarized colonic epithelial cells. Molecular Biology Of The Cell. 2013;24(6):818-31. 

Loberman-Nachum, Nurit; Sosnovski, Katya; Di Segni, Ayelet; Efroni, Gilat; Braun, Tzipi; BenShoshan, Marina; Anafi, Lait; Avivi, Camila; Barshack, Iris; Shouval, Dror S; Denson, Lee A; Amir, Amnon; Unger, Ron; Weiss, Batia; Haberman, Yael. Defining the Celiac Disease Transcriptome using Clinical Pathology Specimens Reveals Biologic Pathways and Supports Diagnosis. Scientific Reports. 2019;9(1):16163. 

Rey, Camille; Chang, Yuen-Yan; Latour-Lambert, Patricia; Varet, Hugo; Proux, Caroline; Legendre, Rachel; Coppée, Jean-Yves; Enninga, Jost. Transcytosis subversion by M cell-to-enterocyte spread promotes Shigella flexneri and Listeria monocytogenes  intracellular bacterial dissemination. Plos Pathogens. 2020;16(4):e1008446. 

Singh, Akaljot; Poling, Holly M; Sundaram, Nambirajan; Brown, Nicole; Wells, James M; Helmrath, Michael A. Evaluation of transplantation sites for human intestinal organoids. Plos One. 15(8):e0237885.