Anti SEC14L1 pAb (ATL-HPA028703)

Atlas Antibodies

Catalog No.:
ATL-HPA028703-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SEC14-like 1 (S. cerevisiae)
Gene Name: SEC14L1
Alternative Gene Name: PRELID4A, SEC14L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020823: 100%, ENSRNOG00000002722: 99%
Entrez Gene ID: 6397
Uniprot ID: Q92503
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG
Gene Sequence SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG
Gene ID - Mouse ENSMUSG00000020823
Gene ID - Rat ENSRNOG00000002722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEC14L1 pAb (ATL-HPA028703)
Datasheet Anti SEC14L1 pAb (ATL-HPA028703) Datasheet (External Link)
Vendor Page Anti SEC14L1 pAb (ATL-HPA028703) at Atlas Antibodies

Documents & Links for Anti SEC14L1 pAb (ATL-HPA028703)
Datasheet Anti SEC14L1 pAb (ATL-HPA028703) Datasheet (External Link)
Vendor Page Anti SEC14L1 pAb (ATL-HPA028703)