Anti RUNDC1 pAb (ATL-HPA023726)

Atlas Antibodies

Catalog No.:
ATL-HPA023726-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RUN domain containing 1
Gene Name: RUNDC1
Alternative Gene Name: DKFZp761H0421
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035007: 92%, ENSRNOG00000023768: 94%
Entrez Gene ID: 146923
Uniprot ID: Q96C34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSQFGCATGQIPPTLWQRVQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLP
Gene Sequence VSQFGCATGQIPPTLWQRVQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLP
Gene ID - Mouse ENSMUSG00000035007
Gene ID - Rat ENSRNOG00000023768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RUNDC1 pAb (ATL-HPA023726)
Datasheet Anti RUNDC1 pAb (ATL-HPA023726) Datasheet (External Link)
Vendor Page Anti RUNDC1 pAb (ATL-HPA023726) at Atlas Antibodies

Documents & Links for Anti RUNDC1 pAb (ATL-HPA023726)
Datasheet Anti RUNDC1 pAb (ATL-HPA023726) Datasheet (External Link)
Vendor Page Anti RUNDC1 pAb (ATL-HPA023726)