Anti RSG1 pAb (ATL-HPA041672)

Atlas Antibodies

Catalog No.: ATL-HPA041672-25

Protein Description: REM2 and RAB-like small GTPase 1
Gene Name: RSG1
Alternative Gene Name: C1orf89, MGC10731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073733: 88%, ENSRNOG00000023346: 88%
Entrez Gene ID: 79363
Uniprot ID: Q9BU20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS
• Gene Sequence: VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS
• Gene ID - Mouse: ENSMUSG00000073733
• Gene ID - Rat: ENSRNOG00000023346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.