Anti RSG1 pAb (ATL-HPA041672)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041672-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RSG1
Alternative Gene Name: C1orf89, MGC10731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073733: 88%, ENSRNOG00000023346: 88%
Entrez Gene ID: 79363
Uniprot ID: Q9BU20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS |
| Gene Sequence | VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS |
| Gene ID - Mouse | ENSMUSG00000073733 |
| Gene ID - Rat | ENSRNOG00000023346 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSG1 pAb (ATL-HPA041672) | |
| Datasheet | Anti RSG1 pAb (ATL-HPA041672) Datasheet (External Link) |
| Vendor Page | Anti RSG1 pAb (ATL-HPA041672) at Atlas Antibodies |
| Documents & Links for Anti RSG1 pAb (ATL-HPA041672) | |
| Datasheet | Anti RSG1 pAb (ATL-HPA041672) Datasheet (External Link) |
| Vendor Page | Anti RSG1 pAb (ATL-HPA041672) |