Anti RNF217 pAb (ATL-HPA029598)

Atlas Antibodies

Catalog No.: ATL-HPA029598-100

Protein Description: ring finger protein 217
Gene Name: RNF217
Alternative Gene Name: C6orf172, dJ84N20.1, IBRDC1, MGC26996
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063760: 98%, ENSRNOG00000013323: 98%
Entrez Gene ID: 154214
Uniprot ID: Q8TC41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
• Gene Sequence: GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
• Gene ID - Mouse: ENSMUSG00000063760
• Gene ID - Rat: ENSRNOG00000013323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.