Anti RMDN3 pAb (ATL-HPA009975)

Atlas Antibodies

Catalog No.:
ATL-HPA009975-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: regulator of microtubule dynamics 3
Gene Name: RMDN3
Alternative Gene Name: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070730: 80%, ENSRNOG00000049007: 84%
Entrez Gene ID: 55177
Uniprot ID: Q96TC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
Gene Sequence DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
Gene ID - Mouse ENSMUSG00000070730
Gene ID - Rat ENSRNOG00000049007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RMDN3 pAb (ATL-HPA009975)
Datasheet Anti RMDN3 pAb (ATL-HPA009975) Datasheet (External Link)
Vendor Page Anti RMDN3 pAb (ATL-HPA009975) at Atlas Antibodies

Documents & Links for Anti RMDN3 pAb (ATL-HPA009975)
Datasheet Anti RMDN3 pAb (ATL-HPA009975) Datasheet (External Link)
Vendor Page Anti RMDN3 pAb (ATL-HPA009975)
Citations for Anti RMDN3 pAb (ATL-HPA009975) – 8 Found
Walch, Laurence; Pellier, Emilie; Leng, Weihua; Lakisic, Goran; Gautreau, Alexis; Contremoulins, Vincent; Verbavatz, Jean-Marc; Jackson, Catherine L. GBF1 and Arf1 interact with Miro and regulate mitochondrial positioning within cells. Scientific Reports. 2018;8(1):17121.  PubMed
De Vos, Kurt J; Mórotz, Gábor M; Stoica, Radu; Tudor, Elizabeth L; Lau, Kwok-Fai; Ackerley, Steven; Warley, Alice; Shaw, Christopher E; Miller, Christopher C J. VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis. Human Molecular Genetics. 2012;21(6):1299-311.  PubMed
Lau, Dawn H W; Paillusson, Sebastien; Hartopp, Naomi; Rupawala, Huzefa; Mórotz, Gábor M; Gomez-Suaga, Patricia; Greig, Jenny; Troakes, Claire; Noble, Wendy; Miller, Christopher C J. Disruption of endoplasmic reticulum-mitochondria tethering proteins in post-mortem Alzheimer's disease brain. Neurobiology Of Disease. 2020;143( 32682953):105020.  PubMed
Hartopp, Naomi; Lau, Dawn H W; Martin-Guerrero, Sandra M; Markovinovic, Andrea; Mórotz, Gábor M; Greig, Jenny; Glennon, Elizabeth B; Troakes, Claire; Gomez-Suaga, Patricia; Noble, Wendy; Miller, Christopher C J. Disruption of the VAPB-PTPIP51 ER-mitochondria tethering proteins in post-mortem human amyotrophic lateral sclerosis. Frontiers In Cell And Developmental Biology. 10( 36051435):950767.  PubMed
Yeo, Hyun Ku; Park, Tae Hyun; Kim, Hee Yeon; Jang, Hyonchol; Lee, Jueun; Hwang, Geum-Sook; Ryu, Seong Eon; Park, Si Hoon; Song, Hyun Kyu; Ban, Hyun Seung; Yoon, Hye-Jin; Lee, Byung Il. Phospholipid transfer function of PTPIP51 at mitochondria-associated ER membranes. Embo Reports. 2021;22(6):e51323.  PubMed
Qin, Wei; Myers, Samuel A; Carey, Dominique K; Carr, Steven A; Ting, Alice Y. Spatiotemporally-resolved mapping of RNA binding proteins via functional proximity labeling reveals a mitochondrial mRNA anchor promoting stress recovery. Nature Communications. 2021;12(1):4980.  PubMed
Cook, Katelyn C; Tsopurashvili, Elene; Needham, Jason M; Thompson, Sunnie R; Cristea, Ileana M. Restructured membrane contacts rewire organelles for human cytomegalovirus infection. Nature Communications. 2022;13(1):4720.  PubMed
Guyard, Valentin; Monteiro-Cardoso, Vera Filipa; Omrane, Mohyeddine; Sauvanet, Cécile; Houcine, Audrey; Boulogne, Claire; Ben Mbarek, Kalthoum; Vitale, Nicolas; Faklaris, Orestis; El Khallouki, Naima; Thiam, Abdou Rachid; Giordano, Francesca. ORP5 and ORP8 orchestrate lipid droplet biogenesis and maintenance at ER-mitochondria contact sites. The Journal Of Cell Biology. 2022;221(9)  PubMed